PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00127429001
Common NameGSBRNA2T00127429001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MIKC_MADS
Protein Properties Length: 237aa    MW: 26593.9 Da    PI: 6.6899
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00127429001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF901.2e-281059251
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         +i+n + rqvtfskRr g++KKAeELSvLCda+va+iifsstgkl+e++s
  GSBRNA2T00127429001 10 KIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCS 59
                         69**********************************************96 PP

2K-box52.52.2e-18941702197
                K-box  21 lakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                          +a L kei    + +R++ Ge+L+ Ls++eLqqLe++Le++l+++ ++K+e ++++i++lq+k  +l + nk+Lr++
  GSBRNA2T00127429001  94 HALLSKEIAGKSHRLRQMRGEELQGLSIEELQQLEKALESGLTRVIETKSEKIMNEISYLQRKGMQLMDVNKRLRQQ 170
                          556667777777889************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.333161IPR002100Transcription factor, MADS-box
SMARTSM004323.7E-40160IPR002100Transcription factor, MADS-box
CDDcd002659.08E-40277No hitNo description
PRINTSPR004043.5E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.14E-31375IPR002100Transcription factor, MADS-box
PfamPF003194.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.21587180IPR002487Transcription factor, K-box
PfamPF014865.0E-1693170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MAREKIQIRK IDNATARQVT FSKRRRGLFK KAEELSVLCD ADVALIIFSS TGKLFEFCSS  60
SMREVLERHN LQSKNLEKLD QPSLELQLVE NSDHALLSKE IAGKSHRLRQ MRGEELQGLS  120
IEELQQLEKA LESGLTRVIE TKSEKIMNEI SYLQRKGMQL MDVNKRLRQQ GTQLTGENER  180
LGQQIFNNVH ERYGGGESEN TAVYEQGHSS ESITNAGNST GAPVDSESSD ISLRLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J5e-19369268Myocyte-specific enhancer factor 2A
3p57_I5e-19369268Myocyte-specific enhancer factor 2A
3p57_D5e-19369268Myocyte-specific enhancer factor 2A
3p57_C5e-19369268Myocyte-specific enhancer factor 2A
3p57_B5e-19369268Myocyte-specific enhancer factor 2A
3p57_A5e-19369268Myocyte-specific enhancer factor 2A
3kov_J5e-19369268Myocyte-specific enhancer factor 2A
3kov_I5e-19369268Myocyte-specific enhancer factor 2A
3kov_B5e-19369268Myocyte-specific enhancer factor 2A
3kov_A5e-19369268Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.292030.0bud
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00127429001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ9229440.0DQ922944.1 Brassica rapa subsp. campestris cultivar Yeorumsinkwan short vegetative phase protein (SVP) mRNA, complete cds.
GenBankDQ9229450.0DQ922945.1 Brassica rapa subsp. campestris cultivar Nornagbom short vegetative phase protein (SVP) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013600280.11e-168PREDICTED: MADS-box protein SVP
RefseqXP_013708009.11e-168PREDICTED: MADS-box protein SVP-like
SwissprotQ9FVC11e-152SVP_ARATH; MADS-box protein SVP
TrEMBLA0A078CI691e-171A0A078CI69_BRANA; BnaC08g34920D protein
STRINGBra038511.1-P1e-164(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-153MIKC_MADS family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]